PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11486.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family B3
Protein Properties Length: 292aa    MW: 33595.7 Da    PI: 9.7886
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11486.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3551.5e-17176267295
                 EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
          B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                 f  ++++++  + ++v+p +f++e ++k++    +tl  ++ rsW vk+  ++++g++ l++GW +Fvk+n+Lk g ++vF+ +++++ +++v 
  KHN11486.1 176 FIREMHPSYIHKYIMVMPGNFLTEDQQKEND--SVTLWISEERSWHVKFYTNRSGGQINLSTGWVDFVKDNNLKIGNVCVFEQIKKTRISFRVF 267
                 55566777777778********999877666..59999999********66888888*************************665444444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.842190IPR003340B3 DNA binding domain
CDDcd100173.00E-9188No hitNo description
SMARTSM010191.3E-6390IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.4E-141090IPR015300DNA-binding pseudobarrel domain
PfamPF023628.1E-81289IPR003340B3 DNA binding domain
SuperFamilySSF1019361.73E-151297IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-21168270IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.24E-22169270IPR015300DNA-binding pseudobarrel domain
CDDcd100173.14E-15174270No hitNo description
PROSITE profilePS5086313.493175272IPR003340B3 DNA binding domain
PfamPF023625.8E-15175269IPR003340B3 DNA binding domain
SMARTSM010190.0012176272IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MQYTILTISS SQRIPRSFVN KCWEGISNPV LLLLPNGVEW KVKWKKLDAD ILLIEDWKEF  60
AEFCSLDKDH LLVFEYLRKS QFLVVIFDQN GLEMEYPLMG GTLDGDEKGN SLCQHKRAKS  120
PVPFSSSIKK VKGKTLTSGR GRGMMNAKRR CSNSNALKSS TALERAKAFR SENPFFIREM  180
HPSYIHKYIM VMPGNFLTED QQKENDSVTL WISEERSWHV KFYTNRSGGQ INLSTGWVDF  240
VKDNNLKIGN VCVFEQIKKT RISFRVFIFR DGEESSPSNF SGNLKIIINI VV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618269.11e-113PREDICTED: uncharacterized protein LOC102661616
TrEMBLA0A0B2PPZ80.0A0A0B2PPZ8_GLYSO; B3 domain-containing transcription factor VRN1
STRINGGLYMA20G24211.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14649515
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.15e-24B3 family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]